{"id":5659973353629,"title":"Beanfields Vegan Cracklins - Spicy Nacho 99g","handle":"beanfieldsvegancracklins-spicynacho99g-case-6","description":"\u003cp\u003e\u003cspan style=\"box-sizing: border-box; margin: 0px; padding: 0px; font-weight: bold;\"\u003e\u003c\/span\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003cspan style=\"box-sizing: border-box; margin: 0px; padding: 0px; font-weight: bold;\"\u003e\u003c\/span\u003e\u003cspan style=\"color: #333333; font-family: Arial; font-size: 15px; font-weight: bold; white-space: pre-wrap;\"\u003e\u003c\/span\u003eBeanfields grain-free Vegan Cracklins are an amazing guilt-free alternative that’s made from navy beans, and are packed with pork-rind-like crunchiness in every bite. With amazing texture and bold flavor, they’re low in calories and are packed with healthy protein and fiber in every serving. Gluten-free and made only with non-GMO ingredients you can pronounce, you’ll feel good about indulging with Beanfields!\u003c\/p\u003e\n\u003cp\u003eDo you like to Nacho like it’s hot? You’ll certainly love this new take on a familiar favorite with a picante twist! We’ve added the perfect amount of spice to the Nacho you know and love, making you say, “this is nacho average Cracklin!”\u003c\/p\u003e\n\u003c!-- TABS --\u003e\n\u003ch5\u003eReviews\u003c\/h5\u003e\n\u003cp\u003eReviews go here\u003c\/p\u003e\n\u003ch5\u003eIngredients\u003c\/h5\u003e\n\u003cp\u003e99g. Ingredients: Navy beans, safflower or sunflower oil, cassava flour, chickpea protein, seasoning blend (tapioca maltodextrin, ancho chile, contains 2% or less of spices, salt, cane sugar, citric acid, natural vegan flavors)\u003c\/p\u003e\n\u003cp\u003eVegan. Gluten-free, GMO-free.\u003c\/p\u003e\n\u003c!-- \/TABS --\u003e","published_at":"2021-05-05T08:38:24+10:00","created_at":"2020-09-25T16:19:45+10:00","vendor":"Beanfields","type":"Food","tags":["Gluten-free","Snack Food"],"price":799,"price_min":799,"price_max":799,"available":true,"price_varies":false,"compare_at_price":799,"compare_at_price_min":799,"compare_at_price_max":799,"compare_at_price_varies":false,"variants":[{"id":36360470757533,"title":"Default Title","option1":"Default Title","option2":null,"option3":null,"sku":"852565003923","requires_shipping":true,"taxable":true,"featured_image":null,"available":true,"name":"Beanfields Vegan Cracklins - Spicy Nacho 99g","public_title":null,"options":["Default Title"],"price":799,"weight":100,"compare_at_price":799,"inventory_quantity":5,"inventory_management":"shopify","inventory_policy":"deny","barcode":"","requires_selling_plan":false,"selling_plan_allocations":[]}],"images":["\/\/cdn.shopify.com\/s\/files\/1\/0864\/2280\/products\/9e9bad218723d76350928610708ea20fa3a2338f.png?v=1601014785","\/\/cdn.shopify.com\/s\/files\/1\/0864\/2280\/products\/Beanfieldscracklinnachonutr.png?v=1601015680"],"featured_image":"\/\/cdn.shopify.com\/s\/files\/1\/0864\/2280\/products\/9e9bad218723d76350928610708ea20fa3a2338f.png?v=1601014785","options":["Title"],"media":[{"alt":null,"id":11342916911261,"position":1,"preview_image":{"aspect_ratio":1.0,"height":1024,"width":1024,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/0864\/2280\/products\/9e9bad218723d76350928610708ea20fa3a2338f.png?v=1601014785"},"aspect_ratio":1.0,"height":1024,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/0864\/2280\/products\/9e9bad218723d76350928610708ea20fa3a2338f.png?v=1601014785","width":1024},{"alt":null,"id":11343175614621,"position":2,"preview_image":{"aspect_ratio":0.476,"height":806,"width":384,"src":"https:\/\/cdn.shopify.com\/s\/files\/1\/0864\/2280\/products\/Beanfieldscracklinnachonutr.png?v=1601015680"},"aspect_ratio":0.476,"height":806,"media_type":"image","src":"https:\/\/cdn.shopify.com\/s\/files\/1\/0864\/2280\/products\/Beanfieldscracklinnachonutr.png?v=1601015680","width":384}],"requires_selling_plan":false,"selling_plan_groups":[],"content":"\u003cp\u003e\u003cspan style=\"box-sizing: border-box; margin: 0px; padding: 0px; font-weight: bold;\"\u003e\u003c\/span\u003e\u003cstrong\u003e\u003c\/strong\u003e\u003cspan style=\"box-sizing: border-box; margin: 0px; padding: 0px; font-weight: bold;\"\u003e\u003c\/span\u003e\u003cspan style=\"color: #333333; font-family: Arial; font-size: 15px; font-weight: bold; white-space: pre-wrap;\"\u003e\u003c\/span\u003eBeanfields grain-free Vegan Cracklins are an amazing guilt-free alternative that’s made from navy beans, and are packed with pork-rind-like crunchiness in every bite. With amazing texture and bold flavor, they’re low in calories and are packed with healthy protein and fiber in every serving. Gluten-free and made only with non-GMO ingredients you can pronounce, you’ll feel good about indulging with Beanfields!\u003c\/p\u003e\n\u003cp\u003eDo you like to Nacho like it’s hot? You’ll certainly love this new take on a familiar favorite with a picante twist! We’ve added the perfect amount of spice to the Nacho you know and love, making you say, “this is nacho average Cracklin!”\u003c\/p\u003e\n\u003c!-- TABS --\u003e\n\u003ch5\u003eReviews\u003c\/h5\u003e\n\u003cp\u003eReviews go here\u003c\/p\u003e\n\u003ch5\u003eIngredients\u003c\/h5\u003e\n\u003cp\u003e99g. Ingredients: Navy beans, safflower or sunflower oil, cassava flour, chickpea protein, seasoning blend (tapioca maltodextrin, ancho chile, contains 2% or less of spices, salt, cane sugar, citric acid, natural vegan flavors)\u003c\/p\u003e\n\u003cp\u003eVegan. Gluten-free, GMO-free.\u003c\/p\u003e\n\u003c!-- \/TABS --\u003e"}

Beanfields Vegan Cracklins - Spicy Nacho 99g

Product Description
Maximum quantity available reached.

or make 4 interest-free payments of $2.00 AUD fortnightly with More info

Beanfields grain-free Vegan Cracklins are an amazing guilt-free alternative that’s made from navy beans, and are packed with pork-rind-like crunchiness in every bite. With amazing texture and bold flavor, they’re low in calories and are packed with healthy protein and fiber in every serving. Gluten-free and made only with non-GMO ingredients you can pronounce, you’ll feel good about indulging with Beanfields!

Do you like to Nacho like it’s hot? You’ll certainly love this new take on a familiar favorite with a picante twist! We’ve added the perfect amount of spice to the Nacho you know and love, making you say, “this is nacho average Cracklin!”

Please note: Prices and stock levels may differ between our Online, Sydney & Melbourne shops.

99g. Ingredients: Navy beans, safflower or sunflower oil, cassava flour, chickpea protein, seasoning blend (tapioca maltodextrin, ancho chile, contains 2% or less of spices, salt, cane sugar, citric acid, natural vegan flavors)

Vegan. Gluten-free, GMO-free.